SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6W3Y0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6W3Y0
Domain Number 1 Region: 81-223
Classification Level Classification E-value
Superfamily Sortase 5.36e-33
Family Sortase 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A6W3Y0
Sequence length 238
Comment (tr|A6W3Y0|A6W3Y0_KINRD) Sortase family protein {ECO:0000313|EMBL:ABS01519.1} KW=Complete proteome; Reference proteome OX=266940 OS=SRS30216). GN=Krad_0027 OC=Kineococcus.
Sequence
MIRRATSVLGELLVTAGVLTLLFVVWQLHWTDLTSGRAQAATVTSLQQQWDAAPAPTATA
GAAATAAPTAPATARAVDETPPTGDAFAILHVPRFGEDYAVPVVEGTGTEELKEGIGHYA
DAALPGEVGNFAIAGHRVTYGKPFHLIADLQEGDAVVVATATQWFTYRVRSHEVVSPKQV
SVIAPVPGRPGETPTEAWLTMTACHPMHSARQRYVVHAQLESVQDRSAGPPASLTAAG
Download sequence
Identical sequences A6W3Y0
gi|152963999|ref|YP_001359783.1| 266940.Krad_0027 WP_012085665.1.7041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]