SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6W5F1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6W5F1
Domain Number 1 Region: 21-93
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.58e-18
Family GntR-like transcriptional regulators 0.02
Further Details:      
 
Domain Number 2 Region: 111-245
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.00000000000000863
Family GntR ligand-binding domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A6W5F1
Sequence length 263
Comment (tr|A6W5F1|A6W5F1_KINRD) Regulatory protein GntR HTH {ECO:0000313|EMBL:ABS02040.1} KW=Complete proteome; Reference proteome OX=266940 OS=SRS30216). GN=Krad_0551 OC=Kineococcus.
Sequence
MTQTDAARSRAGATPGTAGTGGPRVAAVTERLVTAIATGQYLPGSRLPPERDLAAALGAG
RMTVRAALAHLARRGLIETHRGRHGGSFVLQQWPDSSTEIVGRTLSATYAQLRDLCEAIA
RLHGAVCRAAAEHRSPADLERIGAALEAYAAAGSGLASQQADSALHLALIDAAHNDTLRR
VLADLEGQLSIGAPAHLWGAPEGMHAMEARALREHRDLVAAVAGRRADDAERIARAHVAI
DLELLSAALARTGALPAGTPTAP
Download sequence
Identical sequences A6W5F1
WP_012085123.1.7041 gi|152964520|ref|YP_001360304.1| 266940.Krad_0551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]