SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6W871 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6W871
Domain Number 1 Region: 83-216
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.15e-22
Family GntR ligand-binding domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 11-81
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.21e-16
Family GntR-like transcriptional regulators 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A6W871
Sequence length 218
Comment (tr|A6W871|A6W871_KINRD) Transcriptional regulator, GntR family {ECO:0000313|EMBL:ABS03010.1} KW=Complete proteome; Reference proteome OX=266940 OS=SRS30216). GN=Krad_1522 OC=Kineococcus.
Sequence
MDTASPSRTGSPPPAADRVYAEVKHGILDRSLPGGLLLTEGEIADRVGVSRTPVREGLLK
LQAEGLVHLIPKRGALVVPVSPAEVEDVLETRELVEVHTAARAWEHRGELAEALRPHLEA
MRAAVDDPWAFMHADRTFHAAVVRSAGNEVLAGIYDSLRDRQMRMGVANVHGSSDRIATA
LADHERLREALLGEDREDWLALVRDHVRRAGDRLRAVR
Download sequence
Identical sequences A6W871
266940.Krad_1522 gi|152965490|ref|YP_001361274.1| WP_011981851.1.7041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]