SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6W9B8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6W9B8
Domain Number 1 Region: 75-210
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.07e-26
Family GntR ligand-binding domain-like 0.012
Further Details:      
 
Domain Number 2 Region: 4-73
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000427
Family GntR-like transcriptional regulators 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A6W9B8
Sequence length 213
Comment (tr|A6W9B8|A6W9B8_KINRD) Transcriptional regulator, GntR family {ECO:0000313|EMBL:ABS03407.1} KW=Complete proteome; Reference proteome OX=266940 OS=SRS30216). GN=Krad_1921 OC=Kineococcus.
Sequence
MSAPRGLSDTVHDAILELLMNRGLEPGSALRTQTLAVRLGVSATPVREALARLEGSGLVV
RSARRGYRAAPLLSPEELAQLVDVRLLVEPGNAERACARSDDAFVARLWSAVEDQRTAPT
GPGYAGFKHYLEADWSFHELVAQGTGNPFIVRTLDSFRGFVQRLHQVEERVSDADESVSE
HEAIVRAFEQRDPAAAATAMRAHLRGVLDRAVG
Download sequence
Identical sequences A6W9B8
266940.Krad_1921 gi|152965887|ref|YP_001361671.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]