SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6ZU46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6ZU46
Domain Number 1 Region: 4-314,353-381
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.47e-76
Family WD40-repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 351-504
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000174
Family WD40-repeat 0.05
Further Details:      
 
Weak hits

Sequence:  A6ZU46
Domain Number - Region: 634-749
Classification Level Classification E-value
Superfamily TPR-like 0.0177
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A6ZU46
Sequence length 889
Comment (tr|A6ZU46|A6ZU46_YEAS7) Coatomer subunit beta' {ECO:0000256|PIRNR:PIRNR005567} KW=Complete proteome OX=307796 OS=Saccharomyces cerevisiae (strain YJM789) (Baker's yeast). GN=SCY_1929 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MKLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRA
GKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLT
VKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLT
TGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTL
PIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSL
GNDEPTLSLDPVGKLVWSGGKNAAASDIFTAVIRGNEEVEQDEPLSLQTKELGSVDVFPQ
SLAHSPNGRFVTVVGDGEYVIYTALAWRNKAFGKCQDFVWGPDSNSYALIDETGQIKYYK
NFKEVTSWSVPMHSAIDRLFSGALLGVKSDGFVYFFDWDNGTLVRRIDVNAKDVIWSDNG
ELVMIVNTNSNGDEASGYTLLFNKDAYLEAANNGNIDDSEGVDEAFDVLYELSESITSGK
WVGDVFIFTTATNRLNYFVGGKTYNLAHYTKEMYLLGYLARDNKVYLADREVHVYGYEIS
LEVLEFQTLTLRGEIEEAIENVLPNVEGKDSLTKIARFLEGQEYYEEALNISPDQDQKFE
LALKVGQLTLARDLLTDESAEMKWRALGDASLQRFNFKLAVEAFTNAHDLESLFLLHSSF
NNKEGLVTLAKDAETTGKFNLAFNAYWIAGDIQGAKDLLIKSQRFSEAAFLGSTYGLGDN
EVNDIVTKWKENLILNGKNTVSERVCGAEGLPGSSSSGDAQPLIDLDSTPAPEQADENKE
AEVEDSEFKESNSEAVEAEKKEEEAPQQQQSEQQPEQGEAVPEPVEEES
Download sequence
Identical sequences A6ZU46
tr|A6ZU46|A6ZU46_YEAS7 YGL137W YGL137W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]