SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6ZWI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6ZWI9
Domain Number 1 Region: 33-139
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.69e-31
Family Thioltransferase 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A6ZWI9
Sequence length 150
Comment (tr|A6ZWI9|A6ZWI9_YEAS7) Glutaredoxin {ECO:0000256|PIRNR:PIRNR005894} KW=Complete proteome OX=307796 OS=Saccharomyces cerevisiae (strain YJM789) (Baker's yeast). GN=SCY_5666 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MFLPKFNPIRSFSPILRAKTLLRYQNRMYLSTEIRRAIEDAIESAPVVLFMKGTPEFPKC
GFSRATIGLLGNQGVDPAKFAAYNVLEDPELREGIKEFSEWPTIPQLYVNKEFIGGCDVI
TSMARSGELADLLEEAQALVPEEEEETKDR
Download sequence
Identical sequences A0A0L8VFT5 A6ZWI9 B3LL09 C8ZIX1
YPL059W YPL059W SCRT_02433 YPL059W YPL059W YPL059W YPL059W YPL059W YPL059W tr|A6ZWI9|A6ZWI9_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]