SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7BAJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A7BAJ5
Domain Number - Region: 284-407
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0115
Family Carbon-carbon bond hydrolase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A7BAJ5
Sequence length 576
Comment (tr|A7BAJ5|A7BAJ5_9ACTO) Uncharacterized protein {ECO:0000313|EMBL:EDN80219.1} KW=Complete proteome OX=411466 OS=Actinomyces odontolyticus ATCC 17982. GN=ACTODO_00659 OC=Actinomyces.
Sequence
MGAMAVSFLGVIAAFAMYAVSVAPSLMARSWAWHAVASGVLVSCGYIAGVVIQNVGARVI
AMTGLTIRASEPVEIGFRVCIAALFAIWWLYAVIQSHRRARVAARLVNMPGETFGEYLLG
TAGTVVIAWCLIAIVAGLNRLGRMLIGVLGGYMPRPAAIVVGVAILAAIVFFLTSNVILR
GGIGFFRHHAEQMNTRTARGIYKPFVPERSASPASPVTWESVGGQGRVFLGRGPSRLDIA
QVTGGEAMEPIRVYSGMPAGGAGIEQAAATVVAELRRTGAFDRAVILIAASTGSGWVDEW
QVQPLEFLTRGNCATASLQYSYVPSALNWLTGLEPAQEASAVLFRAVRAELDAMDEADRP
ALFVCGESLGAFASQSVFSSVEEALSQVDGALWVGTPAFTPMHAELTSARHKGSPEVAPV
VYNGRRVRFVNEPSDLRTDLYGRELGPWGFPRIVYAQHASDPVVWWNRKLLWTQPDWLRE
RAGRDVSPFVEFTRFVTFIQVLTDLPVAGTAPGGHGHTYNEELIPLWRAILGFDLLFDET
PTHPRLAALDGEWVDEEMVERIGIVVRANLELSDRQ
Download sequence
Identical sequences A7BAJ5
ACTODO_00659 WP_003791228.1.82230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]