SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A7GAJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7GAJ9
Domain Number 1 Region: 159-427
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 8.55e-62
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000223
Further Details:      
 
Domain Number 2 Region: 457-546
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0000000000314
Family YkuI C-terminal domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A7GAJ9
Sequence length 560
Comment (tr|A7GAJ9|A7GAJ9_CLOBL) Methyl-accepting chemotaxis protein {ECO:0000313|EMBL:ABS42559.1} KW=Complete proteome OX=441772 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F). GN=CLI_0523 OC=Clostridium.
Sequence
MKNKLIRQIALLFNVLILILCATFFIGTKSILKGLENNDPNLLASFSSSYLKFIAIMFII
MLAVSYIVVKVFVTKAYNSIEEVAEIIDRVSKGEFATRVPEEGILEPIGVSVNAIVRNTK
KILSDLLQISQKNRIISNTLHENALDSNQATENIASSVISVAETATTQADSTTSTRNNTS
EMAENSTVIAEKAQNTKNIAEEMVKTIKENQKTFETMIYKIKSTGDVSKKLAKNVRILES
EAEEISKITDVVTEISERTNLLALNAAIEAARAGEHGKGFSVVADEVRKLAEQSSESAGE
IRKLIEKITYQITNITEEAENQSKEVEEDIVYADESRESFNEIISSTDETYNSVEQIYDL
SDKNTTISKEVDQLMETIASGAQQSASMTEEISAAVEEQSASINEITQLIKEMNVCTDEI
DSELKAFVTNITIKREQKQLVNEGFNILEKISREINSNNLSVDACSNICKQYVEANNQFE
YIGVIDKEGIMKSANVPITKGNDDFSHRPYFKKAILGERYTSKPYISSVSYNYCIAIAIP
LKDKNGNIQAVAMGDVCIEE
Download sequence
Identical sequences A7GAJ9
gi|153941165|ref|YP_001389809.1| 441772.CLI_0523 gi|384460879|ref|YP_005673474.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]