SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7H940 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7H940
Domain Number 1 Region: 167-312
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.31e-37
Family Histidine kinase 0.0027
Further Details:      
 
Domain Number 2 Region: 111-167
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000135
Family Homodimeric domain of signal transducing histidine kinase 0.0078
Further Details:      
 
Weak hits

Sequence:  A7H940
Domain Number - Region: 15-68
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.0979
Family Hypothetical protein TM1112 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A7H940
Sequence length 322
Comment (tr|A7H940|A7H940_ANADF) Histidine kinase {ECO:0000313|EMBL:ABS25236.1} KW=Complete proteome; Reference proteome OX=404589 OS=Anaeromyxobacter sp. (strain Fw109-5). GN=Anae109_1027 OC=Cystobacterineae; Anaeromyxobacteraceae; Anaeromyxobacter.
Sequence
MTGNARTTPPQGAAAGTRELVENGTTSFPRRKAPVVVRVERGTVLVTREGDLDDHVLEAG
DELVLPPGGLAVGWAFTAATISVREDRRRDRARQGSAPELPRAWDVEALGMTVAHELKNP
LTGVKALVQLGLRNPAEARSHERLALLEREITRMQRILQRHLSSSRRQLTRAPVALGPLV
ADALAVLSARADEARVRLVWRGDATVEADPLRLEEALVNLVANAIEATPRGGEVVVEVLQ
QGDSAEIAVRDTGRGMRPETLRRVGTPFFTTREDGTGLGVALARSAFAEHGGSLRYESAP
GKGTTVRATLPARPALEATAAS
Download sequence
Identical sequences A7H940
gi|153003895|ref|YP_001378220.1| WP_011985342.1.20576 404589.Anae109_1027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]