SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7HAQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7HAQ5
Domain Number 1 Region: 226-395
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.24e-46
Family Histidine kinase 0.00042
Further Details:      
 
Domain Number 2 Region: 413-532
Classification Level Classification E-value
Superfamily CheY-like 4.13e-31
Family CheY-related 0.0062
Further Details:      
 
Domain Number 3 Region: 156-238
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000184
Family Homodimeric domain of signal transducing histidine kinase 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A7HAQ5
Sequence length 537
Comment (tr|A7HAQ5|A7HAQ5_ANADF) Histidine kinase {ECO:0000313|EMBL:ABS25801.1} KW=Complete proteome; Reference proteome OX=404589 OS=Anaeromyxobacter sp. (strain Fw109-5). GN=Anae109_1597 OC=Cystobacterineae; Anaeromyxobacteraceae; Anaeromyxobacter.
Sequence
MAVSAQPTATRAPTPPEREPDSRTHERVEEAFETGAGERPTSPLVRYTVAAACGACMLAA
SGALESVLHGFVFSLPVAGVALVVYTLGPGPSVLFSAVVAYGFWRYFQAPFQSHQEVARL
AAFSVASLSITLSVGLLQRAQLRIRQEKSRVERAERELRHSNALLLETDRHKDQFLAMLS
HELRNPLSPIRNALALIDRSPPGSAEAVRARAIVNRQVIHLTRMVDDLLDVTRISRGRIR
LQRSRVDLAEVLRRTVEDHRSLFASRNIAVEVHLGEVPSWLEADPTRLSQVIGNLLQNAA
KFTDPGGHVRVALERRAGAAVVRVRDDGAGIAPAMLGRVFEPFTQADDTLHRSRGGLGLG
LALVKGLVELHGGEVEVHSEGAGRGTELSVQLPLAPEAPALRMETPVPVASVPPLRVLVI
EDNVDAAETLRELLLMWGHEVEVALDGGTGLERTRLLRPDVVLCDIGLPVMDGYEVARAI
RSDPSLASTFLVAVTGYALPEDQRRAAEAGFGRHLAKPVALETIEALLASVPRLGRA
Download sequence
Identical sequences A7HAQ5
WP_011985907.1.20576 gi|153004460|ref|YP_001378785.1| 404589.Anae109_1597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]