SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7HAX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7HAX9
Domain Number 1 Region: 437-608
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.2e-44
Family Histidine kinase 0.0019
Further Details:      
 
Domain Number 2 Region: 627-747
Classification Level Classification E-value
Superfamily CheY-like 1.85e-32
Family CheY-related 0.012
Further Details:      
 
Domain Number 3 Region: 373-449
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000012
Family Homodimeric domain of signal transducing histidine kinase 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A7HAX9
Sequence length 755
Comment (tr|A7HAX9|A7HAX9_ANADF) Histidine kinase {ECO:0000256|SAAS:SAAS00924638} KW=Complete proteome; Reference proteome OX=404589 OS=Anaeromyxobacter sp. (strain Fw109-5). GN=Anae109_1671 OC=Cystobacterineae; Anaeromyxobacteraceae; Anaeromyxobacter.
Sequence
MRATSTMSAPAHWPRRPIALRRLLVALALGSLLPIGGFAAIVVWRLTGEERASIERRLIH
AARLLAGDVDREMIATFRTLRALAESDRLDAGALGAFDGDARRVLATQPSWRAVLLSTPD
GVHLLNTLHPPGAEPEHTFDRASLARVVETRAPAVGDLARRPEGWSVALRVPVIRDGQVK
YVLTALMSPAAFADLAGRAQRPEEEWTRVITDSAGVVVARTRDPERFVGVSATATYQERT
RGAAEGVYRDTTLDGAEVYLAFARAAVSGWTAGIAVPSHLIEGPTRHSSLAIMAAGLALL
VLSVGGAIVMSRRLSAGIALAATAAETLARGGRPRPAPSRVAELERLGEALERSAALLRS
REAERDEHLARAEAARAQAETASRTKDEFLAMLGHELRNPLSPIVTALQLIKLRGDGQPR
EYSIIERQVSHMSRLVEDLLDVSRITRGKIVLQPELLELSSVVAKALEMAGPLLEARAHR
LAVDVPAEGLPVRGDPVRLAQIVANLLTNAAKYTPPGGHVEVWAGRHGAEISLTVSDDGQ
GLSPELLPRLFDLFVQGPRAPDRHEGGLGLGLAVVKSLVTAHGGTVEAQSAGLGRGSTFT
VRLPAAAAEAAPPALGPRPGALRRAARPLRVLVVDDNADAAELLAAVLSAAGHAVRAAHD
GVGALAALDQFTPEVAVLDIGLPVMDGHELAARIRDRMGAAPPAFIALTGYGQATDLARS
RAAGFEHHLVKPVDADALLAVLEALAADRSAPRAS
Download sequence
Identical sequences A7HAX9
WP_011985981.1.20576 gi|153004534|ref|YP_001378859.1| 404589.Anae109_1671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]