SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7HCP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7HCP2
Domain Number 1 Region: 12-119
Classification Level Classification E-value
Superfamily RmlC-like cupins 1.55e-21
Family dTDP-sugar isomerase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7HCP2
Sequence length 120
Comment (tr|A7HCP2|A7HCP2_ANADF) Cupin 2 conserved barrel domain protein {ECO:0000313|EMBL:ABS26488.1} KW=Complete proteome; Reference proteome OX=404589 OS=Anaeromyxobacter sp. (strain Fw109-5). GN=Anae109_2286 OC=Cystobacterineae; Anaeromyxobacteraceae; Anaeromyxobacter.
Sequence
MATTFDRPKRVEKPWGHELWWAQTDRYVGKLLHVKAGSQLSLQYHVKKDETIHLWSGEMI
LVLQDGDRLVDHRMQPGDSFHVKPGTVHRMRAVSDCDVLEVSTPEVDDVVRVQDDYGRTG
Download sequence
Identical sequences A7HCP2
WP_012097074.1.20576 404589.Anae109_2286 gi|153005147|ref|YP_001379472.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]