SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7HDG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7HDG4
Domain Number 1 Region: 125-355
Classification Level Classification E-value
Superfamily RmlC-like cupins 6.5e-77
Family Pirin-like 0.00000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7HDG4
Sequence length 356
Comment (tr|A7HDG4|A7HDG4_ANADF) Pirin domain protein {ECO:0000313|EMBL:ABS26760.1} KW=Complete proteome; Reference proteome OX=404589 OS=Anaeromyxobacter sp. (strain Fw109-5). GN=Anae109_2559 OC=Cystobacterineae; Anaeromyxobacteraceae; Anaeromyxobacter.
Sequence
MRCDGGASRYSSSRSPRGRRCLPLSTARYSLCGRRQRPSHRLRASASRSLPQDGKHRLRE
RPRPRAIGERRSRTYRAHGRSSREPRHRQPLGVRTRMRDRAAGRRAGATGVALIGTARDG
KYAPMITVRRSNDRGHFDHGWLDTRHTFSFADYHDPRHMGFRALRVINEDRVAPGQGFGT
HGHRDMEILSYVLSGRLAHRDSMGSGSSLGPGEVQRMTAGTGVLHSEFNGSDSEPVHFLQ
IWILPGRQGLLPGYEQRAFPEEERRGRLRLVASPDGADGSVTIHQDARVHAGLLGGGDQV
VLSLEADRHAWVQVVRGKLRVGDETLSAGDGAALSEEREVRLAGVDASEVLVFDLA
Download sequence
Identical sequences A7HDG4
404589.Anae109_2559 gi|153005419|ref|YP_001379744.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]