SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7HF45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7HF45
Domain Number 1 Region: 191-295
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000144
Family Heme-binding PAS domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7HF45
Sequence length 316
Comment (tr|A7HF45|A7HF45_ANADF) Hemerythrin HHE cation binding domain protein {ECO:0000313|EMBL:ABS27341.1} KW=Complete proteome; Reference proteome OX=404589 OS=Anaeromyxobacter sp. (strain Fw109-5). GN=Anae109_3145 OC=Cystobacterineae; Anaeromyxobacteraceae; Anaeromyxobacter.
Sequence
MSQTWRELLMTDHETTERVFSAAEKALAAPEGPSPGMVANLREYLVGYVDRCHNQKEEQT
VFPLLQRAGLPVEGGPLAVMLAEHRQAKALVERIDGAAAAFVAGDRARLDDLRDAFGAYA
ALCKDHFWKENDILYPLAARMLDEATQAGIVPGIEAVEAALGPDTRRRYYRIADELVRAV
ELEDLSYGLDRQVLAAILNTLPVELSFVDEEDRVRYFSHERGEKIFPRSRGAIATNVRNC
HPQKSVHLVEKILADFKAGRREVAEFWIDMGPRKVHIRYWPVRDEAGRYLGCLETVQDVS
GIQRLTGQRRLLEEAA
Download sequence
Identical sequences A7HF45
gi|153006000|ref|YP_001380325.1| 404589.Anae109_3145 WP_012097958.1.20576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]