SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7HFH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7HFH8
Domain Number 1 Region: 28-120
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.000000000185
Family TM1287-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A7HFH8
Sequence length 145
Comment (tr|A7HFH8|A7HFH8_ANADF) Uncharacterized protein {ECO:0000313|EMBL:ABS27474.1} KW=Complete proteome; Reference proteome OX=404589 OS=Anaeromyxobacter sp. (strain Fw109-5). GN=Anae109_3285 OC=Cystobacterineae; Anaeromyxobacteraceae; Anaeromyxobacter.
Sequence
MSAKTLLVAATTLVLSPCLAAEPLAGNRYVPADKLPWYKEAPDLPVQLAPLWGDRAKGEG
GTLLRTPGGFDSGLHNHTADYWAVVIEGEWRHWVPSTGEGKGVVLKPGAHWTQIKDQWHQ
DACVSKIPCTIFLFNRDPYVTHFPK
Download sequence
Identical sequences A7HFH8
404589.Anae109_3285 gi|153006133|ref|YP_001380458.1| WP_012098093.1.20576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]