SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7HFP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7HFP7
Domain Number 1 Region: 361-599
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.62e-75
Family Extended AAA-ATPase domain 0.00000104
Further Details:      
 
Domain Number 2 Region: 158-334
Classification Level Classification E-value
Superfamily GAF domain-like 3.27e-25
Family GAF domain 0.017
Further Details:      
 
Domain Number 3 Region: 36-148
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.54e-22
Family Flavin-binding PAS domain 0.086
Further Details:      
 
Domain Number 4 Region: 575-670
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000851
Family FIS-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7HFP7
Sequence length 674
Comment (tr|A7HFP7|A7HFP7_ANADF) Transcriptional regulator, NifA subfamily, Fis Family {ECO:0000313|EMBL:ABS27543.1} KW=Complete proteome; Reference proteome OX=404589 OS=Anaeromyxobacter sp. (strain Fw109-5). GN=Anae109_3359 OC=Cystobacterineae; Anaeromyxobacteraceae; Anaeromyxobacter.
Sequence
MTEVATRYDERGITMDTPPSLRTPGQQAMTDEGWHQLFEHSAIGVTLADLEGHLVHVNRA
YCAMLGYTEVELEGHSYVSHAHPDDRARHLILVRELLADARAHFQVEERYVRKGGSVMWV
SNSVSLVPPRGGSRRILILGLVEDITERMRLRDELDAERNRLRLLLDVNELLVAHLDLRE
MFQALASSLRRVTDCHFIGLALPDAATGELRQHIVDHPDGKGAITEGMVLPLHGSASGKA
FRTGAPVLLNDPEANRQDPDLYGTPEGARFYRTVLEEGVPSGYVLPLVHRGEVLGVLQLK
KYADARFKEREIEFMSKVAGQLSIAVANALEYREVKESKERLDRERVYLKEEIRSAHDFE
EIIGVSRTLKQVLGQIDTVAVTDSTVLILGETGTGKELIARAIHNRSRRRDRPFVKVNCS
AIPTGLLESELFGHERGAFTGATAPRIGRFEAADQGTLFLDEIGDLPVDLQPKLLRVLQE
REFERLGASRTRRVDVRVVAATNRGLATMVGEGRFREDLYYRLNVFPITLPPLRERAGDI
PLLVRHFVGVYARRMGKQIDHIPDASMRALVGYHWPGNVRELQNVIERAVILTPGAVLEL
ALAERAAGAREDRPDAAAPNGHRTLQEVEREHILGALQEAKWVIGGPNGAAARLGLRRTS
LMYRMEKLGIARPT
Download sequence
Identical sequences A7HFP7
404589.Anae109_3359 gi|153006202|ref|YP_001380527.1| WP_012098162.1.20576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]