SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7HI90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7HI90
Domain Number 1 Region: 349-502
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.63e-38
Family Histidine kinase 0.0033
Further Details:      
 
Domain Number 2 Region: 291-355
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000294
Family Homodimeric domain of signal transducing histidine kinase 0.0048
Further Details:      
 
Domain Number 3 Region: 233-282
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000301
Family HAMP domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A7HI90
Sequence length 506
Comment (tr|A7HI90|A7HI90_ANADF) Histidine kinase {ECO:0000313|EMBL:ABS28436.1} KW=Complete proteome; Reference proteome OX=404589 OS=Anaeromyxobacter sp. (strain Fw109-5). GN=Anae109_4258 OC=Cystobacterineae; Anaeromyxobacteraceae; Anaeromyxobacter.
Sequence
MSVDPPPGVRACATRRRAPGGPAGKMRHGYGSGTARRLALGFGALVLLFAAASAVAIAGS
VRIHRGLAEMKPREEGVRLSLELASAVRDQYAHQAHTIIIGDASHLGFYDGARETVLRLT
RALRQAAEEPEERALVDRIEAESRTLDAIFRERIVPAVLAGEQGSVKLEHDRAQLVVTRI
QDLTQALVERFESKIRAFRRDAEGVQRRTLAFLVGLLVAAPVVAVIVSIVIGRSIAAPVA
QLQAGAARIAAGELDARIEVHGAPELEALARQWNATTAALRDHQERLVETEKLAGIGRLA
AGVAHEINNPLGVILGYAKLLRKKAEPAAAEDLAVIEEETLRAKEIVEGLLDLSRPLPAA
AQAVDLRALADDVVARLREARLLDGVAVHVDGGATAPGHPDKLRQVLVNLVRNAAEAAGP
GGRVAVRVGALDGTAEVAVEDSGPGIDAATRGRLFEPFFTTKPRGTGLGLAVSRAIARAH
GGDLAADPAEHGGARFALRLPARGEA
Download sequence
Identical sequences A7HI90
404589.Anae109_4258 gi|153007095|ref|YP_001381420.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]