SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7I5U0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7I5U0
Domain Number 1 Region: 6-253
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.33e-123
Family Methyl-coenzyme M reductase gamma chain 0.000000041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7I5U0
Sequence length 254
Comment (tr|A7I5U0|A7I5U0_METB6) Methyl-coenzyme M reductase subunit gamma {ECO:0000256|PIRNR:PIRNR000264} KW=Complete proteome; Reference proteome OX=456442 OS=Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8). GN=Mboo_0583 OC=Methanoregulaceae; Methanoregula.
Sequence
MAYKPQYCPGQTQVAENRRKQLDPNHKLEKIRDVTDKDLVLIMGHRAPGSAYRAVHPPLS
EQQEPACPIRKIVTPTDGAKAGDRVRYIQFSDSMYNAPCQPYQRSWLESYRYRGIDPGTL
SGRQIIECRERDLEKYAKELVNTELFDPALTGVRGCTVHGHSLRLDENGLMFDMLQRCIL
DKKSGVIKYVKDQVGVPLDSEVKVGKAQDEKWLKSHTTMYHSLVGTGFRDDAEYVEYIQR
IHALRVKYGFMPKE
Download sequence
Identical sequences A7I5U0
WP_012106122.1.2930 456442.Mboo_0583 gi|154150126|ref|YP_001403744.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]