SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7I6B4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A7I6B4
Domain Number - Region: 175-240
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.000471
Family Transglutaminase, two C-terminal domains 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7I6B4
Sequence length 459
Comment (tr|A7I6B4|A7I6B4_METB6) Uncharacterized protein {ECO:0000313|EMBL:ABS55275.1} KW=Complete proteome; Reference proteome OX=456442 OS=Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8). GN=Mboo_0757 OC=Methanoregulaceae; Methanoregula.
Sequence
MKWKLGILSCLLILLMVSAVYADDSSSTTSSTSSSTTSSSSTSSSTSTVDQAALVYVSNI
SLDTNEYFPDDEGTLSVTLTNGGTSAIGLENPTLISPHISTENNDWVGMSFVGAGSSLTY
SIPFTVKPPCGTYFALFTIGTQNGNAIHYPVKIKISSNTLTGAITSQPTSYAPEAEQNVT
LTLMNTRSGDIKNIVITPVGSGIDADPSVELIPTISAGSSSAVTFGITPHQASDLTFNVS
YQDGDNTHYTDVVLPITLGQDKTAAVPIVNNVELTSSGSTQEITGDVTNAGITDAYGVTV
TVGSPAIATGTYPVYAIGSIASDDSGSFDVTFSANDLSAVPLVVSWKDSSGNDYNITKTL
DLSSGTSSTTGSSTSKTSTTSSSSGSMSGGPGGMSGGPGGDMGGPGGSSSSSVTSLFSGS
KGGGISSFYPVIGAVIILIAGIVLWKKRKWILLKLNKKQ
Download sequence
Identical sequences A7I6B4
456442.Mboo_0757 WP_012106298.1.2930 gi|154150300|ref|YP_001403918.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]