SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7KYF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7KYF2
Domain Number 1 Region: 49-235,265-381
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.66e-68
Family Duffy binding domain 0.0000612
Further Details:      
 
Domain Number 2 Region: 2017-2288,2319-2336
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.84e-56
Family Duffy binding domain 0.0000337
Further Details:      
 
Domain Number 3 Region: 1246-1318,1352-1577
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.36e-54
Family Duffy binding domain 0.0000861
Further Details:      
 
Domain Number 4 Region: 559-860,895-911,948-967
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.66e-53
Family Duffy binding domain 0.00054
Further Details:      
 
Domain Number 5 Region: 1573-1912
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-51
Family Duffy binding domain 0.0000743
Further Details:      
 
Domain Number 6 Region: 2339-2456
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.19e-20
Family Duffy binding domain 0.0023
Further Details:      
 
Domain Number 7 Region: 1024-1156
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.000000000471
Family Duffy binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A7KYF2
Sequence length 2457
Comment (tr|A7KYF2|A7KYF2_PLAFA) VAR2CSA {ECO:0000313|EMBL:ABS79815.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN= OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MDSKTTIAEKIEAYLGAKSNDSKIDQSLKADPSEVQYYRSGGDGDYLKNNICKITVNHSD
SGTNDPCDRKELSYGDIDEWKCDENLYKASENNKNIFVPPRRQRMCINNLEKLNVDKIRD
KHAFLADVLLTARNEGERIILYHPDTNSSNVCVALERSFADLADIIRGTDQWKGTNSNLE
KNLKQMFAKIRENDKVLQDKYPNDDENYKKLREDWWTKNRQKVWEVITCSARSNDLLIKR
RWRTSKESEGENKLELCRKCGHYEGKVPTYLDYVPQFLRWLTEWIEDFYREKQNLIDDME
RHREECTSEDHKSKEVTSYCSTCKEKHTKYCECVKKWKSEWENQKNKYTELYEQENETSS
SSKNTSRYDDYVKEFFKNFKGDNYKSLDDYIKGDPYSAEYVTKLSFIPNSSDANNPSEKI
QKNNDEVCNCNESEISSVGQASISDPSSNKTCNTHSSIKANKKKVCKDVKLGVRENDKVL
KICVIEHTSLRGVDNCCFKDLLGILQEPRIDKNQSGSSSNGSCDKNSEEACEKNLEKVLA
SLTNGYKCDKCKSGTSRSKKKWIWKKYSGKEGGLQEEYANTIGLPPRTQSLCLVVCLDEK
EGKTQELKNISTNSELLKEWIIAAFPEGKNLKPSPEKKKGDNGKKLCKDLKYSFADYGDL
IKGTSIWDNEYTKDLELNLQKIFGKLFRKYIKKNIASDENTLYSSLDELRESWWNTNKKY
IWLAMKHGAGMNSTMCNADGSVTGSGSSCDDMPTIDLIPQYLRFLQEWVEHFCKQRQEKV
KPVIENCNSCKNTSSERKIGGTCNSDCKTECKNKCEVYKKFIEDCKGGDGTAGSSWSKRW
DQIYKRYSKYIEDAKRNRKAGTKNCGPSSTTNAAENKCVQSDIDSFFKHLIDIGLTTPSS
YLSTVLDDNICGEDNAPWTTYTTYTTTKNCDKDKKKSKSQSCDTLVVVNVPSPLGNTPHE
YKYACECRTPNKQESCDDRKEYMNQWISDNTKNPKGSGSGKDYYELYTYNGVDVKPTTVR
SSSTKLDGNDVMFFNLFEQWNKEIQYQIEQYMTNANISCNNEKNVLSRVSDEGTPNVRGG
YVDGRNNNINQGTNCKKNCECYELWIKKIKEQWGKQKNNYNKFRSKQSNDARKSSQNKKV
VSLSNFLFFSCWEEYIQKQFNGDWSKIKNIGSDTFDFLIKKCGNNSGDGETIFNKKLNNA
NIKCNENASKDTKINKSETSSKCSEPIYIRGCQSKTYDGFISPGKGGEKQWICKDTITHG
DTNGACIPPRTQNLCVGELWYKRYGGRSNIKNDTKESLKNKLKNAIQKETELLYEYHDKG
TAIISRNPMKEGGEDGKGKQKEGGEEANNNSNGLPKGFCHAVQRSFIDYKNMILGTSVNI
YEYIGKLQEDIKKIIEKGTPQQNGKTVGSGADKVNDWWKGIEGEMWGAVKSGIKTIKKQN
NKCTYTGNECGVSPPTGNNEDQSVSWFKEWGEQFCIERLQYEQNIREACTNNGQGDKIQG
ACKRKCEEYKKYISEKKKEWDKQKTKYENKYVGKSASDLLKENYPECISANFDFIFNDNI
EYKTYYPYGDYSSICSCEQVKYYEYNKDNGQNNKSLCHEKGNDRTWSKKYIKKLENGRTL
EGVYVPPRRQQLCLYELFPIIIKNEEGMEKAKEELLETLKIVAEREAYYLWKQYNPTGKG
IDDANKKACCAIRGSFYDLEDIIKGNDLVHDEYTKYIDSKLNEIFGSSNTNNIDTKRART
DWWENETITNVTDRKTIRQLVWDAMQSGVRYAVEEKKEKKKPNENFPPCMGVEHIGIAKP
QFIRWLEEWTNEFCEEYTKYFEDMKSNCNRRKGADDCGDNTNIECKKACANYTNWLNPKR
IEWNGMSNYYNKIYRKSNKESEDGKDYSMIMEPTVIDYLNKRCNGEINGNYICCSCKNIG
ENSTSPAQKTKGSKKKDEQCEEEKGPLDLMNEVLNKMDEKYSAHKMKCTEVYLEHVEEQL
NEIDNAIKDYQLYPLDRCFDDGRKMKICDLIGDAIGCKDKTKLDELDEWNDMDLRDPYNK
YKGVLIPPRRRQLCFSRIVRGPANLRNLKEFKEEILKGAQSEGKFLGNYYKEKKEDRKEK
ALEAMKNSFYDYEYIIKGSDILENIQFKDIKIKLDKLLTKETNNTKKVDDWWETNKKSIW
NAMLCGYKKSGNKIIDPSWCKIPTTEKTPQFLRWIKEWGTNVCIQKEKYKKNVKSECSDV
TNLGAQASESTKCTSEIRKYQEWSRKSSVQWEAISERYKKYKGKDEFKNVKEPDANTYLK
EHCSKCPCGYNDMQEMTNDAENEQDTFKRIIEKVEIPAELEDVIYRIKHHEYDKGNDYIC
NKYKNINVNKRHKNDDTRTDLLVKNSSDINKGVLIPPRRKNLFLYIDPSKICEYKKDPKL
FKDFIYSSAFTEVERLKIVYRQDKEKVANAMKYSFADIGNIIKGDDMMENNSSDKIG
Download sequence
Identical sequences A7KYF2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]