SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7KYF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7KYF6
Domain Number 1 Region: 48-233,263-379
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-67
Family Duffy binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 2358-2625
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.53e-56
Family Duffy binding domain 0.0000854
Further Details:      
 
Domain Number 3 Region: 1997-2275,2306-2321
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.54e-55
Family Duffy binding domain 0.0000427
Further Details:      
 
Domain Number 4 Region: 1248-1565
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.97e-54
Family Duffy binding domain 0.0000812
Further Details:      
 
Domain Number 5 Region: 540-853,889-933
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-51
Family Duffy binding domain 0.00037
Further Details:      
 
Domain Number 6 Region: 1560-1894
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.2e-49
Family Duffy binding domain 0.0000863
Further Details:      
 
Domain Number 7 Region: 974-1160
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0000114
Family Duffy binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A7KYF6
Sequence length 2673
Comment (tr|A7KYF6|A7KYF6_PLAFA) VAR2CSA {ECO:0000313|EMBL:ABS79819.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN= OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MDKSSIGDKIEAYLEKKSNESNIEQSLKADPSEVEYYRSGGDGDYLKNNICKITVNHSDS
GKYDPCDRIPPPYGDNDQWKCQQNSSDGSEKPENICVPPRRERLCTYNLEKLNVEKIRDK
HAFLADVLLTARNEGERIVQNHPDTNSSNVCVALERSFADLADIIRGTDLWKGTNKFEPY
LKQMFAKILEKDSTLKNNYSKKDPKYTKLREDWWTKNRQKVWEVITCSARSNDLLIKRRW
TTSGKSNGENKLELCRKCGHYEGKVPTKLDYVPQFLRWLTEWIADLYREKQNLIDDMERH
REECTREDHKSKEGASYCNMCKEKHTKYCECVKKWKTEWENQKNKYNDLYQQENETSSSS
KKKSRYDDYVKDFFENFKGDNYKSLDDYIKDDPYSKEYTTKLSFILNSSDANTSSGETAN
HNDEACNCNESEISSVGQAQTSGPSSNKTCITHSFIKANKKKVCKDVKLGVRENDKVLRV
CVIEDTSLSGVDNCCCQDLLGILQENCSDNKRGSSSNGSCNNKNQDECQKKLEKVFVSLT
NGYKCDKCKSGTSTVNKKWIWKKSSGNEKGLQKEYANTIGLPPRTQSLYLGNLPKLGNVC
EDVTDINFDTKEKFLAGCLIAAFHEGKNLKISHEKKKGDNGKKLCKALEYSFADYGDLIK
GTSIWDNEYTKDLELNLQKAFGKLFGKYIKKNIASDENTSYSSLDELRESWWNTNKKYIW
TAMKHGAEMNSTMCNADGSVTGSGSSCDDIPTTDFIPQYLRFLQEWVEHFCKQRQEKVNA
VIENCNSCKNTSGERKIGGTCNGDCKTECKNKCEAYKNFIEDCKGGDGTAGSSWVKRWDQ
IYKRYSKHIEDAKRNRKAGTKSCGPSSITNASVSTDENKCVQSDIDSFFKHLIDIGLTTP
SSYLSIVLDENNCGEDNAPWTTYTTYTTTEKCNKDKKKSKSQSCNTAVVVNVPSPLGNTP
HEYKYACQCKIPTTEETCDDRKEYMNQWISDTSKKQKGSGSTNNDYELYTYTGVKETKLP
KKLNSPKLDDKDVMFFNLFEQWNKEIQYQIEQYMTNTKISCIDEKEVLDSVSDEGTPKVR
GGYEDGRNNNINQGTNCREKCKCYELWIKKITEQWGKQKNNYNKFQRKQIYDANKGPQNK
KVVSLSHFLFFSCWEEYIQKYFNGDWSKIKNIGSDTFEFLIKKCGNDSGDGETIFSEKLK
NANIKCNENASKDTKINKSGKSCDCNEPIYIRGCQPKIYDGKIFPGKGGEKQWICKDTII
HGDTNGACIPPRTQNLCVGELWYKSYGGRSNIKNDTKESLKNKLKNAIQKETELLYEYHD
KGTAIISKNDKKGQKGKNDPNGLPKGFCHAVQRSFIDYKNMILGTSVNIYEYIGKLQEDI
KKIIEQERTKQKDKTVGSEDKVNDWWKGIEGEMWGAVKCAITKINKKNNKCTYTGNECGI
FPPTGNDEDQFVSWFKEWGEQFCIERLQYEQNIRDACTNNGQGDKIQGACKRKCEEYKKY
ISEKKKEWDKQKTKYENKYVGKSASDLLKENYPECISANFDFIFNDNIEYKTYYQYGDYS
SICSCEQVKYYKYNKDKGQNNKSLCHEKGNDRTWSKKYIKKLENGRTLEGVYVPPRRQQL
CLYELFPIIIKNEEGMEKAKKELLETLQIVAEREAYYLWKQYHAHNDTTYLAHKKACCAI
RGSFYDLEDIIKGNDLVHDEYTKYIDSKLNEIFGSSNTNDIDTKRARTDWWENEIITNGT
DRKTIRQLVWDAMQSGVRYAVEEKKENFPPCMGVEHIGIAKPQFIRWLEEWTNEFCEKYT
KYFEDMKSNCNLRKGADDCGDNSNIECKKACANYANWLNPKRIEWNGMSNYYNKIYRKSN
KESEDGKDYSMIMEPTVIDYLNKRCNGEINGNYICCSCKNIGENSTSPVANKKAQRKDED
EEEKGPLDLMNEVLNKMDPKYSAHKMKCTEVYLEHVEEQLNEIDNAIKDYQLYPLDRCFD
DKSKMKVCDLIADAIGCKDKTKLDELDEWNDMDLRDPYNKYKGVLIPPRRRQLCFSRIVR
GPANLRNLKEFKEEILKGAQSEGKFLGNYYNEDKGKEKKEDRKEKALEAMKNSFYDYEYI
IKGTDMLANIKFKDIKRKLDKLLTKETNNTKKAEDWWETNKKSIWNAMLCGYKKSGNKII
DPSWCTIPTTEKTPQFLRWIKEWGTNVCIQKEKYKEYVRSECSDVTNNNLGSQASESNNC
TSEIKKYQEWSRNRYVQWDAISERYKKYKRMDEFKNVKEPDANTYLREHCSKCPCGFNDM
QEMNNNEDNEKEAFKQIKEQVDIPAELEDVIYRLKHHEYNSNDYFCRKYNNKNLYSRMQH
NIDTIWTDLLVKNSSDINKDVLIPPRRKNLFLYIDPSKICEYKKNPKLFKDFIYWSAFTE
VERLKIVYRQDKEKVANAMKYSFADIGSIIKSDDMMEKNSSDKIGKILGDTDGQNEKRKK
WWDSNKYHIWESMLCGYKQAGGDTETNENCRFPDTDGVPQFLRWFQEWTETFCVTRQELY
DKLNSECISAECTNGSVDNSKCTHACVNYKNYILTKKTEYEIQTNKYDNEFKNKNDNAKD
APDYLKEKCNDNKCECLNKHIDDKNKTWKNPYETLEDTFKSKCDCPKPVPPPPEKPQPPP
LTPSDEPFDPTILQTTIPFGIALALGSIAFLFM
Download sequence
Identical sequences A7KYF6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]