SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7KYF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7KYF8
Domain Number 1 Region: 49-235,265-386,413-431
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-69
Family Duffy binding domain 0.00013
Further Details:      
 
Domain Number 2 Region: 2030-2304,2335-2352
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.31e-55
Family Duffy binding domain 0.0000235
Further Details:      
 
Domain Number 3 Region: 1255-1587
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-53
Family Duffy binding domain 0.0000966
Further Details:      
 
Domain Number 4 Region: 529-731,760-861,897-940
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.83e-52
Family Duffy binding domain 0.00046
Further Details:      
 
Domain Number 5 Region: 1582-1775,1804-1922
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.96e-47
Family Duffy binding domain 0.00016
Further Details:      
 
Domain Number 6 Region: 2354-2551
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.02e-41
Family Duffy binding domain 0.00059
Further Details:      
 
Domain Number 7 Region: 1030-1165
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0000000000471
Family Duffy binding domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A7KYF8
Sequence length 2551
Comment (tr|A7KYF8|A7KYF8_PLAFA) VAR2CSA {ECO:0000313|EMBL:ABS79821.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN= OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MDSTSTIADKIEAYLKEKSNDSKIEQSLKADPSEVQYYGSGGDGYYLKNNICKITVNHSD
SGTNDPCDRKLPPYGDNDQWKCAIILSKVSEKPENVFVPPRRQRMCIKNLENLNVEKIRD
KHAFLADVLLTARNEGERIILYHPDTNSSNVCVALERSFADLADIIRGTDQWKGTNSNLE
QNLKQMFKNILEKDKVLQDKYQNDDENYKKLRESWWTKNRQKVWEVITCSARSNDLLIKR
GWRTSKESEGENKLELCRKCGHYEGKVPTKLDYVPQFLRWLTEWIEDFYREKQNLIDDME
RHREECTRKYVECKEGTSYCNMCKEKHTKYCECVKKWKTEWKNQKNKYKDLYEQNKNETS
SSPKKKSRYDDYVKEFFKKLNEANYKSLDDYIKDDPYSAEYATKLSFILNPSDANTSSGE
TANHNDEVCNCNESEIASVELAPISDSSSNKTCITHSFIGANKKKECKDVKLGVREKDKD
LKICVIEDDSLRGVENCCCQDLLGILQENCSDNKSGSSSNGSCDKNSEDECQKKLENVFA
SLKNGYKCDKCKSGTSTVNKKWIWRKYSGNGEGLQKEYANTIGLPPRTHSLYLVCLHEKE
GKTQHKTISTNSELLKEWIIAAFHEGKNLKTSHQNNNSGNKKKLCKALKYSFADYGDLIK
GTSIWDNDFTKDLELNLQKIFGKLFRKYIKKNIASDENTSYSSLDELRESWWNTNKKYIW
LAMKHGAEMNSTMCNGDGSVTGSSDSGSTTCSGDNGSISCDDIPTIDLIPQYLRFLQEWV
EHFCKQRQEKVKDVITNCKSCKESGDTCNSDCEKKCKNKCEAYKKFIEERRTAAQGTAES
SWVKRWDQIYMRYSKYIEDAKRNRKAGTKSCGPSSTTNAAASTAENKCVQSDIDSFFKHL
IDIGLTTPSSYLSIVLDDNICGADNAPWTTYTTYTTTKNCDIKKKTPKPQSCDTLVVVNV
PSPLGNTPHEYKYACQCRTPNKQESCDDRKEYMNQWSSGSAQTVRGRSTNNDYELYTYNG
VKETKPLGTLKNSKLDGNDVMFFNLFEQWNKEIQYQIEQYMTNTKISCNNEKNVLSRVSD
EGTPNVRGGYVDGGNNNINQGTNCKEKCECYELWIKKIKEQWGKQKDNYNKFETKQIYDA
NKGPQNKKVVSLSNFLFFSCWEEYIQKYFNGDWSKIKNIGSDTFEYLIKKCGNNSGDGET
IFSEKLNNAHIKCNENESTNNKMKSSETSCDLNATNYIRGCQPKIYDGKIFPGKGGEKQW
ICKDTIIHGDTNGACIPPRTQNLCVGELWYKSYGGRSNIKNHTKELLKNKLKNAIQKETE
LLYEYHDKGTAIISQNDKKEKANNNKNSNGLPKGFCHAVQRSFIDYKNMILGTSVNTYEY
IGKLQEDIKKIIEQETTKQNGKTVGSGAENVNAWWKEIEKDMWDAVRCGIKRINKKQKKN
GTFNGNECGVSPPTGNDEDQFVSWFKEWGEQFCIERLRYEQNIREACTNNGKNGKKCINS
KSGQGDKVEGACKRKCEKYKKYISEKKQEWDKQKTKYENKYVGKSASDLLKENYPECISA
NFDFILNDNIEYKTYYPYGDYSSICSCEQVKYYEYIKDKGQNNKSLCHEKGNDRTWSKKY
IKKLENGRTLEGVYVPPRRQQLCLYELFPIIIKNEEGMENVEKELLETLQIVAEREAYYL
WKQYNPPGKGIDDANKKAHKKACCAIRGSFYDLEDIIKGNDLVHDEYTKYIDSKLNKIFG
SNTNNIDTKRARTDWWENKTIDVPKIDVANGPDPKTIRQLVWDAMQSGVRKAIDEENENF
PPCMRVQHIGIAKPQFIRWLEEWTNEFCEEYTKYFGAINSKCDPPKGADDCDDNSNIECK
KACANYTNWLNPKRIEWNGMSNYYNKIYRKSNKESEDGKDYSMIMEPTVIDYLNKRCHGE
INGNYICCSCKNIGENSTSGTVNKKLQRKDEQCEDNKGPLDLMNEVLNKMDEKYSEHKMK
CTEVYLEHVEEQLKEIDNAIKDYQLYPLDRCFDDQTKMKVCDLIGDAIGCKDKTKLDELD
EWNDMDLRDPYNKYKGVLIPPRRRQLCFSRIVRGPANLRNLNEFKEEILKGAQSEGKFLG
NYYNEDKDKEKALEAMKNSFYDYEYIIKGSDILENIQFKDIKRKLDKLLTKETNNNIQNA
EDWWKVNNKSIWNAMLCGYKKSGNKIIDPSWCTIPTTEKTPQFLRWIKEWGTNVCIQKEK
YKEYVKSECSNVTNLGAQESESNNCTSEIKKYQEWSRKRSIQWEAISERYKKYKGMDEFK
NTFKNIKEPDANEYLKEYCSKCPCGFNDMQEITKYTNIGNEAFNTIIEKVKIPAELEDVI
YRLKHHEYDKGNDYICNKYKNINVNMKKNNDDTWTDLVKNSSDINKGVLIPPRRKNLFLY
IDPSKICEYKKNPKLFNDFIYSSAFSEVERLKKAYGEARAKVANAMKYSFADIGNIIKGD
DMMKSPTSKYMDKLFTSNKYSGINRETWWNENKYHIWEAMLCGYQKGKNNTHSEKLDEAW
CDLPMEGNIPQFLRWFQEWIESFCSHRKKLY
Download sequence
Identical sequences A7KYF8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]