SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7MBF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7MBF3
Domain Number 1 Region: 141-296
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.07e-28
Family Dual specificity phosphatase-like 0.0012
Further Details:      
 
Domain Number 2 Region: 4-148
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.000000000000167
Family Ubiquitin carboxyl-terminal hydrolase 8, USP8 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A7MBF3
Sequence length 309
Comment (tr|A7MBF3|A7MBF3_BOVIN) Serine/threonine/tyrosine interacting like 1 {ECO:0000313|Ensembl:ENSBTAP00000012447} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=STYXL1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MTGLVLCEPTELYNILNQVTKLSRLTEPNYLCLLDVRSKREYDESHVITALLVKKRAGKY
LIPESVDLECVEYCVVYDNNTISLELMLKDDSTDDGKHRIVLGAAVECGRALTHLTRHPV
LILRGGYELFSAMYHFFRTQKIIWMPQELDAFQPYPIEIMPGRIYLGNFKQACDPKIQKD
LKISAHVNISMETGPFFVGDADKLLHIQIEDSLEANITPFLRHLCHFIDIHLELNSVILV
FSTLGISRSCAAILAYLMHWNGQTLKKSWAYLKKCKNNMRPNRALVAQLSEWEKVVLGDI
VTDIQNPPY
Download sequence
Identical sequences A7MBF3
ENSBTAP00000012447 9913.ENSBTAP00000012447 ENSBTAP00000012447 NP_001095438.1.59421 NP_001095438.1.76553 XP_005225150.1.76553 XP_005892887.1.15283 XP_010852623.1.44457 XP_010852624.1.44457 XP_015315921.1.76553 XP_015315922.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]