SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7MBF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7MBF7
Domain Number 1 Region: 5-186
Classification Level Classification E-value
Superfamily Nudix 5.96e-28
Family MutT-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A7MBF7
Sequence length 210
Comment (tr|A7MBF7|A7MBF7_BOVIN) Nudix hydrolase 8 {ECO:0000313|Ensembl:ENSBTAP00000042086} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=LOC616332 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MLPDCLSAEGEQRCRRLLAGATARLRARPAAAAVLVPLCSVRGVPALLYTLRSSRLAGRH
KGDVSFPGGKCDPADRDVVHTALRETQEELGMAVPEEQVWGVLRPVHDREKATVVPVLAG
VGPVDPQSLRPNPEEVDEVFALPLAHLLQEQNQGYTHFCRGGHFQYTLPVFLHGPHRVWG
LTAVITEFTLKLLAPGVYQPRLAGPELPRG
Download sequence
Identical sequences A7MBF7
ENSBTAP00000042086 9913.ENSBTAP00000042086 ENSBTAP00000042086 NP_001094725.1.59421 NP_001094725.1.76553 XP_010835981.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]