SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7NJM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7NJM9
Domain Number 1 Region: 285-430,494-525,761-859
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.87e-20
Family ABC transporter ATPase domain-like 0.033
Further Details:      
 
Domain Number 2 Region: 11-110,142-237
Classification Level Classification E-value
Superfamily PHP domain-like 0.0000000000000628
Family PHP domain 0.0074
Further Details:      
 
Weak hits

Sequence:  A7NJM9
Domain Number - Region: 498-662
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0105
Family BAR domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A7NJM9
Sequence length 909
Comment (tr|A7NJM9|A7NJM9_ROSCS) SMC domain protein {ECO:0000313|EMBL:ABU57699.1} KW=Complete proteome OX=383372 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8). GN=Rcas_1607 OC=Roseiflexaceae; Roseiflexus.
Sequence
MTEKSLYHGARWIRCDLHLHSPGAHGFTFPPGLSAAQRDEVVAQYVQQLQAQGIAIAAIT
DYQQIRTKWFIPIQQEAKKAGIYVYPGVELSFGGSVAGKYGLHVLAIFPYDSDLQEINRR
IDKLLDGDVQEELVRENGSHRDLKPRENLADCLIRLRRETGCLLVFAHPNDENGLWKTYQ
PGEAADLLVRVEPDAIEQFEERDRQRLQDTGKVHPTLLGRIACVRSSDNHSIAEIGTKTL
SEGAPRATYVKLSVLDDLRAIRLALHDHALLVRVGEPPKAEYTHFVHLEIEGNGFLGGLS
LDFSPEMNVLIGGRGVGKSALLEVIRYALDLPAYAPTAYREGLVKHALGSGGKVVLAFYQ
VVRPGIERHYRIERVWDEQPRVFEGERSVSLSPLEVLGEREAPLFFGQREIYEVTQSARL
RRRLLDEIIGRTAEMQLGQVKRITEELQRNARTILEHQERLAQRKDLEKRLQEIEHQIAL
YQQYGITQKLQQATALARDEERLKRAHEQLSQAQADWQEVQQRLAEHWTNALAGLKQADS
VQAALLQQAAEVLRGLQDAFDGYLQQGEASFQQARAEFDRLLARWEQERRPLDEEIQRLK
RELGTQSLDPDVLIRLTQEQEALRPQWETLRKIETTTANLQEERREKLADLREQRRQVFQ
LRQQQAQVISQALKDRVSVVVEYRGQRQEFAERLSAFFSGSGLDKESLRRLAEKGTDGIA
LAEWVRQGEKALCQNADLTSARAQQMLRFLEQNPQRIYELEVLAPEDEVEVQLKVNDLWL
PLEKLSAGQRATAMLLILLTQHDRLLLIDQPEDDLDNRFIFDDVVPLLREQKGKRQIIAA
THNPNIPVLGHAELVVALEAQEEHAAVAIQGAIDRKTVQDVVRRVMEGGEEAFRRRAEKY
GLNIQGGSG
Download sequence
Identical sequences A7NJM9
gi|156741588|ref|YP_001431717.1| WP_012120127.1.48654 383372.Rcas_1607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]