SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7S1C6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7S1C6
Domain Number 1 Region: 102-191
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.57e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00095
Further Details:      
 
Domain Number 2 Region: 24-96
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00023
Further Details:      
 
Domain Number 3 Region: 239-316
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A7S1C6
Sequence length 338
Comment (tr|A7S1C6|A7S1C6_NEMVE) Predicted protein {ECO:0000313|EMBL:EDO42485.1} KW=Complete proteome; Reference proteome OX=45351 OS=Nematostella vectensis (Starlet sea anemone). GN=v1g236828 OC=Edwardsiidae; Nematostella.
Sequence
MSADEEQVASRPAESRPAKGRGHSSNLVLKMIMQGKDIGSIIGKEGSTIKQFRQESNAHI
NISDGSTPERIVSVTGTKDAVVTAFALIGQKLEDELKSNSKSNTTPPVTLRLIVPGSQCG
SIIGKGGAKIKEIREVSGASVVVAGEFLPGSSERAVTLSGTPEALETCIDLLCGVMIEFP
PRGHPMPYTPHKLQQQFGFYGPPQGFGYPGPYGMPHAFPNGFMAGRGPYGGGRKGKGPPP
PQPGPITSHTMTILKGAVGSIIGQKGSYITGIRQMSGASIKIGDSENGDDKREVLITGTA
EAVGLAQFLINARLRQDGKSPVVTDKDKPHNAENGDAE
Download sequence
Identical sequences A7S1C6
45351.JGI236828 XP_001634548.1.94760 jgi|Nemve1|236828|estExt_fgenesh1_kg.C_580003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]