SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7SAG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7SAG7
Domain Number 1 Region: 4-46
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000024
Family Laminin-type module 0.0061
Further Details:      
 
Domain Number 2 Region: 62-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000921
Family Laminin-type module 0.05
Further Details:      
 
Domain Number 3 Region: 111-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000103
Family Laminin-type module 0.0033
Further Details:      
 
Domain Number 4 Region: 166-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family Laminin-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A7SAG7
Sequence length 208
Comment (tr|A7SAG7|A7SAG7_NEMVE) Predicted protein {ECO:0000313|EMBL:EDO39274.1} KW=Complete proteome; Reference proteome OX=45351 OS=Nematostella vectensis (Starlet sea anemone). GN=v1g111045 OC=Edwardsiidae; Nematostella.
Sequence
CIPCRCNGHSNECDPETGECINCQDNTAGDRCQFCVKGFYGNATIGKPGDCQLCKCPLGT
SSNSFASECNVRGDGSLECLCREGYTGDQCEQCADGYYGDPSVPGDYCKKCDCNGNIDPD
VSEWALCNPFTGVCNRCTNKAAGDRCERCRDGYYGDAVVAKNCAKCECSACGAVTSVCNH
TNGACQCKANVIGPNCSTCKVSHVAQWE
Download sequence
Identical sequences A7SAG7
45351.JGI111045 XP_001631337.1.94760 jgi|Nemve1|111045|e_gw.103.86.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]