SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7SZH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7SZH7
Domain Number 1 Region: 115-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000135
Family EGF-type module 0.011
Further Details:      
 
Domain Number 2 Region: 37-74
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000191
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 1-41
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000274
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 75-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000132
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A7SZH7
Sequence length 156
Comment (tr|A7SZH7|A7SZH7_NEMVE) Predicted protein {ECO:0000313|EMBL:EDO30895.1} KW=Complete proteome; Reference proteome OX=45351 OS=Nematostella vectensis (Starlet sea anemone). GN=v1g139161 OC=Edwardsiidae; Nematostella.
Sequence
CLSKPCANGGTCSPISSGSDYTCACAAGYTGKNCTADVDECSSSPCQNGASCIKKVGRYF
CECSTAHVGKNCHKKPDPCLSKPCANGGTCSPISSGSDYTCACAAGYTGKNCTADVDECS
SSPCQNGASCIKKVGRYFCECSTAHVGKNCHKSKFF
Download sequence
Identical sequences A7SZH7
jgi|Nemve1|139161|e_gw.463.11.1 45351.JGI139161 XP_001622995.1.94760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]