SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7UFI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7UFI1
Domain Number 1 Region: 27-577
Classification Level Classification E-value
Superfamily SIS domain 2.11e-210
Family Phosphoglucose isomerase, PGI 0.00000000000000708
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A7UFI1
Sequence length 581
Comment (tr|A7UFI1|A7UFI1_LEIPE) Glucose-6-phosphate isomerase {ECO:0000256|RuleBase:RU000612} OX=5681 OS=Leishmania peruviana. GN=GPI OC=Leishmaniinae; Leishmania; Leishmania braziliensis species complex.
Sequence
MATATFNAPYEIARKTKVLGASDSSLSKLSAWKRLEFLYEKYGNESILSHFEKDQQRFSR
YSIEVPLQCDDNFLFLDYSKSHINDEVKDALVALAEERGVRAFIKAMFDGQQVNSTEKRA
VLHVALRNRSNRAINVNGKDIMTDVNLVLAQMKDFTDKVRSGEWKGQTGKSIHYIVNVGI
GGSDLGPVMVYESLKPFSMRDMHCFFVSNVDGTHMAEVLKQVNMEETIFIIASKTFTTQE
TLTNAMSARNAFIDYLKSNNIPSDGAVAKHFVAISTNAKEVREFGIDTANMFEFWDWVGG
RYSVWSAIGLSVMLSIGYENFVEFLTGAHVIDNHFASAPVEQNLPMMLALVGIWYNNFFG
AETQAVLPYDQYLWRLPAYLQQLDMESNGKGVTKKSGAVTVQTGPIIFGEAGTNGQHAFY
QLIHQGTKIIPCDFIGCVQTQNRVGDHHRILMSNFFAQTEALMVGKSAEEVRQELVKSGM
PSDAIESLLPHKTFTGSRPSNSILVNALTPRALGAIIAMYEHKVLVQGAIWGINSYDQWG
VELGKVLAKSILPQLKSGNIVSNHDGSTNGLINMFNTRAHL
Download sequence
Identical sequences A4H6W2 A7UFI1
gi|154333685|ref|XP_001563099.1| psu|LbrM12_V2.0490 XP_001563099.1.15230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]