SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7UTI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7UTI6
Domain Number 1 Region: 176-265
Classification Level Classification E-value
Superfamily DEATH domain 2.86e-19
Family DEATH domain, DD 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A7UTI6
Sequence length 279
Comment (tr|A7UTI6|A7UTI6_ANOGA) IMD pathway signalling Immune Deficiency (Imd) {ECO:0000313|VectorBase:AGAP004959-PB} KW=Complete proteome; Reference proteome OX=7165 OS=Anopheles gambiae (African malaria mosquito). GN=AgaP_AGAP004959 OC=Culicidae; Anophelinae; Anopheles.
Sequence
MVKFSNLIGTLFSKSAASKLETDAAPLPPRRKADAYGDETMAHTNTPAAAAATQNGNFPN
GVQVVPGMENLALVPGGSSQSLEPVAGEHHTATPQTVVNNVQHNTLTAPQTSISNTTGMQ
VFQIRNASNLHIGNSYTFNTAAVVDEGASTSGSLPGAGSAVKWANLRLSNTISQMMQSQD
EVDTELLDTVSRHLGYEWKSFARRLEYSEGQIDAFEADNSTLAEQIYSFMLDWTRNDDDP
TLGRLVTLLWNNKHKETVYYIKQVWKKRKEDKNSPERSS
Download sequence
Identical sequences A7UTI6
AGAP004959-PB|IMD XP_001688608.1.40869 AGAP004959-PB

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]