SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7YJ84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7YJ84
Domain Number 1 Region: 2-148
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.01e-41
Family Proline iminopeptidase-like 0.00000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A7YJ84
Sequence length 149
Comment (tr|A7YJ84|A7YJ84_BRUAO) Proline iminopeptidase {ECO:0000313|EMBL:ABU98509.1} OX=235 OS=Brucella abortus. GN=pip OC=Brucellaceae; Brucella.
Sequence
NPDGKPVIMIHGGPGGGITPTMRRLHDPKRYRIILFDQRGCGRSTPHAELRENTTWDLVA
DMEHIRAHLGIDKWQVFGGSWGSTLGLAYAETHPERVSELVLRGIFMVRRFEVDWMYSNG
ASIIFPDHFEAYQEHIPEAERGDMIAAYY
Download sequence
Identical sequences A7YJ84

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]