SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7YJD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7YJD6
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.87e-42
Family Proline iminopeptidase-like 0.00000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A7YJD6
Sequence length 153
Comment (tr|A7YJD6|A7YJD6_BRUSS) Proline iminopeptidase {ECO:0000313|EMBL:ABU98539.1} OX=29461 OS=Brucella suis. GN=pip OC=Brucellaceae; Brucella.
Sequence
NPDGKPVIMIHGGPGGGITPTMRRLHDPKRYRIILFDQRGCGRSTPHAELRENTTWDLVA
DMEHIRAHLGIDKWQVFGGSWGSTLGLAYAETHPERVSELVLRGIFMVRRFEVDWMYSNG
ASIIFPDHFEAYQEHIPEAERGDMIAAYYKRLT
Download sequence
Identical sequences A7YJ86 A7YJA7 A7YJB2 A7YJC6 A7YJC8 A7YJD6 A7YJE1 A7YJE3 A7YJE8 A7YJF0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]