SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7YYA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7YYA4
Domain Number 1 Region: 96-192
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-23
Family HtrA-like serine proteases 0.00016
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.1e-22
Family Prokaryotic proteases 0.0000841
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A7YYA4
Sequence length 195
Comment (tr|A7YYA4|A7YYA4_DANRE) LOC799537 protein {ECO:0000313|EMBL:AAI52584.1} OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=LOC799537 OC=Cyprinidae; Danio.
Sequence
MGSPFSLKNTITSGIVSSAQRGSKELGLSNSNMDYIQTDATIDFGNSGGPLINLDGEVIG
INTMKVTAGISFAIPLFLDRSADKQKSWFGESGWKRRYIGVMMLTLTPSIIEELRMRDPS
FPDVSHGVLIHRVIVGSPANRAGMKPGDNIIEINGVKVNTSEEIYNAVRTSESLNVVVRR
GADLLMLHMTPESTV
Download sequence
Identical sequences A7YYA4
NP_001103640.1.45394 gi|163915732|gb|AAI57581| gi|288684088|ref|NP_001165761|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]