SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7Z031 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7Z031
Domain Number 1 Region: 539-713
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.17e-51
Family G proteins 0.0000188
Further Details:      
 
Domain Number 2 Region: 8-71
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000885
Family Calbindin D9K 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7Z031
Sequence length 740
Comment (tr|A7Z031|A7Z031_BOVIN) RASEF protein {ECO:0000313|EMBL:AAI53230.1} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=RASEF OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MEADGDLEELARLRSVFAACDANRSGRLEREEFRALCAELRVRPADAEAVFQRLDADRDG
AITFQEFARGFRGARRVGPRRGWGPREPAPAAAQVGSDSGSGEEDEGDEDAAAALAAPWD
PASSGQAWQDFQARLGDEVKFIPRKEQVSTLYQNINLVEPRLIQPYEHVIKNFIREIKLQ
STEMENLAIAVKRAQDKAAMQLSELEEEMDQRIQAAEHKTRKDEKRKAEEALSDLRRQYE
TEVGDLQVTIKKLKKLEEQSKHISQKQDVAALKKQIYDLSMENQKVKKDLLEAQTNIAFL
QSELDSLKSDYADQSLNSERDLEIIREYTEDRNSLERQIEILQTANRKLHDSNDGLRSAL
ENSCSKLSRALRINNISPGNTVSRSSPKFNLHSPQPLGYDRSSRSSYMDEDCDSLALCDP
MQRMNCDVDSLPESCFDSGLSTLRDSNEYDSEVEYKHQRGFQRSHGMQESFGGDASDTDV
PDIRDEETYGSEGVASILDWKPPGSASEGSIISSSRKPISALSPQTDMVDESHKSSSSQK
AYKIVLAGDAAVGKSSFLMRLCKNEFRGNTSATLGVDFQMKMLIVDGERTVLQLWDTAGQ
ERFRSIAKSYFRRADGVLLLYDVTCEKSFLNVREWVDMIEDAAHESIPIMLVGNKADLRD
TAEAEGQKCVPGYFGEKLAMTYGALFCETSAKDGSNIVEAVLHLAREVKKRTDEDDSKSI
TNLSGTSSKKSTQMKNCCNG
Download sequence
Identical sequences A7Z031
9913.ENSBTAP00000028993 ENSBTAP00000028993 NP_001098832.1.59421 NP_001098832.1.76553 ENSBTAP00000028993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]