SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7Z7P3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7Z7P3
Domain Number 1 Region: 35-171
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.05e-27
Family SMI1/KNR4-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7Z7P3
Sequence length 185
Comment (tr|A7Z7P3|A7Z7P3_BACVZ) YokH {ECO:0000313|EMBL:ABS75019.1} KW=Complete proteome; Reference proteome OX=326423 OS=amyloliquefaciens subsp. plantarum). GN=RBAM_026610 OC=Bacillus amyloliquefaciens group.
Sequence
MAVFVEKTLQGLKELIDEKGRLKILGNEGALLETECIFFKGATDLEIESFEKKIKVSLPE
DYKTFLKLHNGARIFDLLFYGENVGGGLHILNVEEIEKYMQNGFLKPQFIPVAHLLDGCY
LLIDKTKMSTDPNYLWFRGFVEYEPMQLNFEIFLDRYIMSQGANFWEWNIYTAENYYRTH
QGDED
Download sequence
Identical sequences A7Z7P3
gi|154687089|ref|YP_001422250.1| 326423.RBAM_026610 WP_012118190.1.37657 WP_012118190.1.44318 WP_012118190.1.80280 gi|556558510|ref|YP_008728045.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]