SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7Z9I8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A7Z9I8
Domain Number - Region: 21-119
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0129
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7Z9I8
Sequence length 180
Comment (tr|A7Z9I8|A7Z9I8_BACVZ) Uncharacterized protein {ECO:0000313|EMBL:ABS75664.1} KW=Complete proteome; Reference proteome OX=326423 OS=amyloliquefaciens subsp. plantarum). GN=RBAM_033340 OC=Bacillus amyloliquefaciens group.
Sequence
MDTFENYIKYDTVDERITLRYKDKLPAELIEVWDKYGLGTLLNGFLKVINPDEYLDILER
CYMRYEQAIPIFTTSMGDIIVWEKDKYVNLLNFRKGHVHVVSSGFDFFFDDLKDNDFMND
ELMWEPYPEASRIYGKPDYDECFGYTPLLGLGGSEKVKNLEKVKLREHILIITEFMGPIE
Download sequence
Identical sequences A0A2D1HUF8 A7Z9I8
326423.RBAM_033340 gi|154687734|ref|YP_001422895.1| WP_012118623.1.37657 WP_012118623.1.44318 WP_012118623.1.54902 WP_012118623.1.80280 WP_012118623.1.86493 gi|556559209|ref|YP_008728744.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]