SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8A8H4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8A8H4
Domain Number 1 Region: 83-206
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 5.5e-19
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.0088
Further Details:      
 
Domain Number 2 Region: 6-86
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.000000153
Family Ferredoxin reductase FAD-binding domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8A8H4
Sequence length 220
Comment (tr|A8A8H4|A8A8H4_IGNH4) Oxidoreductase FAD/NAD(P)-binding domain protein {ECO:0000313|EMBL:ABU81226.1} KW=Complete proteome; Reference proteome OX=453591 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125). GN=Igni_0042 OC=Desulfurococcaceae; Ignicoccus.
Sequence
MSFKVEEVLRSRKLAKGIYETFVSYHGEAPPPGTFFMVWVPGHEAIPLSVAGYRGDAVRF
IVEVRGRTTAALYTAHKVGLLGPLGRQAPVPSGKPLLVGGGVGIAPLLYMKELWGGELLF
GAKSAEKVPKIDGIDEVATEDGSLGFKGTVVDLLKLRPQKRDVYACGPPSMISSLKVLAK
EMGLKGYYSTEKMIKCGIGICGSCVLEGKLLCKEPWLRLG
Download sequence
Identical sequences A8A8H4
WP_011998078.1.33635 453591.Igni_0042 gi|156936837|ref|YP_001434633.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]