SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8A8M0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A8A8M0
Domain Number - Region: 24-68
Classification Level Classification E-value
Superfamily Prefoldin 0.000288
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8A8M0
Sequence length 70
Comment (tr|A8A8M0|A8A8M0_IGNH4) Uncharacterized protein {ECO:0000313|EMBL:ABU81272.1} KW=Complete proteome; Reference proteome OX=453591 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125). GN=Igni_0088 OC=Desulfurococcaceae; Ignicoccus.
Sequence
MKVFGPKGRGAEPPEVKAAELEEALKLIKEGKAKTAYKVFGRVILEVPLEEAERTIRAEL
EELKKRLEGG
Download sequence
Identical sequences A8A8M0
453591.Igni_0088 gi|156936883|ref|YP_001434679.1| WP_011998124.1.33635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]