SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8A902 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8A902
Domain Number 1 Region: 12-192,342-585
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.37e-111
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000077
Further Details:      
 
Domain Number 2 Region: 193-343
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 1.31e-47
Family ValRS/IleRS/LeuRS editing domain 0.00012
Further Details:      
 
Domain Number 3 Region: 578-751
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 3.92e-39
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8A902
Sequence length 792
Comment (tr|A8A902|A8A902_IGNH4) Valyl-tRNA synthetase {ECO:0000313|EMBL:ABU81404.1} KW=Complete proteome; Reference proteome OX=453591 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125). GN=Igni_0220 OC=Desulfurococcaceae; Ignicoccus.
Sequence
MEFKPKLELKRWDFKIEDQVRSWWEKEDWWKFDPNSPKPKFVIDTPPPYPAPLWHIGAAV
SYAMHDMIARAMRMMGYEVLYPIGFDRNGLPIELYVEKYLGLTPWKTDREKFLETCRQVL
DSWVEKMKETLKRLLIAADIDNPYQTDSPDYRAFTQATFIEAWKKGLVYEAERPNNWCPK
CRTTIADAEVEYKEMKGIMAYIKFKVKDSDEELVIATTRPELLCACRAVVVHPDDERYKK
YHGKKVIVPIYGHEIPVLPHKMADPNFGTGAMMVCSFGDWRDVQIFRELGLTPVKAIDEE
GKMTECAGPIAGLKVKEAKMKIVELLKEQGYLVKVEDIVHKVPVHERCETPIEIIPMKEY
YLKQLEFKDVLKKYAEEMKWQPERYKKNLLQWIDSVSTDWPISRRRFYATEIPVWTCKRC
GYKYVPPPGRYYRPWKEDPPIDKCPKCGAREWEGEKRVFDTWMDSSVTVLYITKYMRDEE
FWKKTFLEGVKLRPQGYDIIRTWLYYSLLRVHQLTGKRAFDLVFINGMGLDPKGKKMSKR
YGNVIMPEEILNKYGADATRFWIALEVKPGENYRVIENKIQGAQKFLTKFLNVARYVSSF
PYPEGRVELREADKWILAELAELIEKVRKAYAEMDFHTVAEEFYHFVWDKFSSHYIELSK
KRARMMDERFDEEDAKAAWWTLHTVLKNLLLILAPISPAISDYLWRRLYSSESVHAQRLP
EAPEEWRDEATLEKGRAIMELNSKVWKAKKEVLGKKLSDPVTVEELKSAGVELPELGGFE
EDFMALHNVVRG
Download sequence
Identical sequences A8A902
gi|156937015|ref|YP_001434811.1| 453591.Igni_0220 WP_011998256.1.33635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]