SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8A998 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A8A998
Domain Number - Region: 60-118
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000524
Family GHMP Kinase, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8A998
Sequence length 255
Comment (tr|A8A998|A8A998_IGNH4) GHMP kinase {ECO:0000313|EMBL:ABU81500.1} KW=Complete proteome; Reference proteome OX=453591 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125). GN=Igni_0317 OC=Desulfurococcaceae; Ignicoccus.
Sequence
MIVEVPLHVSGLWRPVWRRSAISTGSLGAGVLLKPGAVCSPGGPRPPVPTALGEVRCKLP
VPVGKGFATSAAIALASAIFKYKSFVEAAARAHVAEVLNKTGLGDVMAIAYGRGVAVRTE
AGGPGWGRVESLEVPRKVFVVGFTVKGLFADTPSMLSSLDVREAFEDAWKALLDGFDFYS
FLEAAEAFSARVGFLKFVEPRLLKLPGVMGGYVKKSAGVLFVEGAYADEVLEEVKKVYKV
ARAFTPASFYMRVAP
Download sequence
Identical sequences A8A998
453591.Igni_0317 WP_011998352.1.33635 gi|156937111|ref|YP_001434907.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]