SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8A9C8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8A9C8
Domain Number 1 Region: 2-363
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.62e-61
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8A9C8
Sequence length 378
Comment (tr|A8A9C8|A8A9C8_IGNH4) Tyrosyl-tRNA synthetase {ECO:0000256|HAMAP-Rule:MF_02009} KW=Complete proteome; Reference proteome OX=453591 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125). GN=Igni_0347 OC=Desulfurococcaceae; Ignicoccus.
Sequence
MDEKIRLIMREPTEEVLTPELLKEYIEQGVPLKHYIGFEISGFVHLGTGIVTMRKVADLQ
RAGVKTTLFLADYHSWINKKLGGDLDTIKRVALGYFKEALLQSLKAVGGDPESVEVILAS
EFFEKLGIKYFENFLRVSNRLTLARVKRSITIMGRKEGESVNFGQLVYVPMQVADIFSLG
VNLAHGGMDQRKAHVIAIEVGPKEFGYKPVALHHHLLLGLHIDEETREKLLKAKREGDRE
AFEEGIVEIKMSKSVPQSAIFVHDSPEEIKRKLKRAYCPIGEVEMNPVLEIVKYVVFPWL
EDLGRSFEVVNKKTGERKEYKSYQEVERDFAAKALHPLDLKLAVAEYLVEMLKPVREYFV
EGPGKKYLEEMKEIQITR
Download sequence
Identical sequences A8A9C8
gi|156937141|ref|YP_001434937.1| 453591.Igni_0347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]