SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8A9P6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8A9P6
Domain Number 1 Region: 3-315
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.29e-45
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000113
Further Details:      
 
Domain Number 2 Region: 354-492
Classification Level Classification E-value
Superfamily An anticodon-binding domain of class I aminoacyl-tRNA synthetases 3.53e-18
Family C-terminal domain of class I lysyl-tRNA synthetase 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8A9P6
Sequence length 496
Comment (tr|A8A9P6|A8A9P6_IGNH4) Lysyl-tRNA synthetase {ECO:0000256|HAMAP-Rule:MF_00177} KW=Complete proteome; Reference proteome OX=453591 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125). GN=Igni_0465 OC=Desulfurococcaceae; Ignicoccus.
Sequence
MEWLNKIVDEIIKKRGGRAFVVASGLTTSGPAHLGTLSEFIYPYSIVQELRRRGYDAEFV
FVADIMDAFDDIPQTLKDKEEELKKHLGKPLAEVPDPYGCHESYGEHFLAEFLELMDKFG
IKPDEVLRASELYAQGWYDDYLRLFVEQRDKVKKIMEETAMRKLPDDWWGFVKPICEKCG
RIDKTVVKKVEGDKIYYKCEACGHEGAVEVSSHRWKLAWRLDWPSRQDFLGVDAEGGGVD
HFTKGGSWDTAKRIHKEVFGKEPPVGFRYGFVLMNGKKMSKSKGIGALHEIMALLHPSVI
MYFILKHDIKENKNFKMDPRFLMQLYEEYRRVALGEDEDPKRRRAWELSGGRVWRAGFAD
LLVYYQIYRDWKKVGELTGDPQAVKDLAPYVEEWVKRGFVPEEYEVTVKQGKVSDPKGCE
FLRALAEELREDMDAVEIHNKVYEVAKKVGLSPKDAFKFVYKALLDKERGPRAGRLIKAI
GVRKAKEMFEKACSPT
Download sequence
Identical sequences A8A9P6
gi|156937259|ref|YP_001435055.1| 453591.Igni_0465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]