SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8A9V1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8A9V1
Domain Number 1 Region: 4-184,308-378
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.31e-48
Family Bacterial dinuclear zinc exopeptidases 0.001
Further Details:      
 
Domain Number 2 Region: 184-300
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 5.68e-18
Family Bacterial exopeptidase dimerisation domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8A9V1
Sequence length 385
Comment (tr|A8A9V1|A8A9V1_IGNH4) Acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase {ECO:0000313|EMBL:ABU81703.1} KW=Complete proteome; Reference proteome OX=453591 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125). GN=Igni_0521 OC=Desulfurococcaceae; Ignicoccus.
Sequence
MSPQEVLDLLSQLISFDTVSPEGKQYEDLVHFLKGWLEERGVSAKVEYVDDEYRSSHCPQ
GPKPLLFAWVGEGEPLLEFNGHYDVVPPGDGWEGNPFEPKVVGEYLVGRGATDMKGGVAA
VAASLAELSNWKGNKVQAVFVPDEEVGGRCGTGYRVSKLKEKYPIGRHVVIAEPSSKSVW
IGHKGAVWLEVKVKGSQAHASTPWMGENAFLKASNVATALYYALVERFSKRYSKYEYTSE
HPLAKFNTVSVGGVAYSTSNKVNVIPGSFVFSVDIRVIPEESAERVAEEVYSLLPEYAEA
KALEMMEPFINEGSEVAEVIREAWGHPPKVCEGGLDLRYYKGYDAVAWGPGEISEAHKPN
EKVRISDVLEFARMYSQLPLLLKRR
Download sequence
Identical sequences A8A9V1
gi|156937314|ref|YP_001435110.1| WP_011998555.1.33635 453591.Igni_0521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]