SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8A9X0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8A9X0
Domain Number 1 Region: 23-145
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.83e-17
Family GHMP Kinase, N-terminal domain 0.008
Further Details:      
 
Domain Number 2 Region: 216-261
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00000000518
Family Galactokinase 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8A9X0
Sequence length 272
Comment (tr|A8A9X0|A8A9X0_IGNH4) Shikimate kinase {ECO:0000256|HAMAP-Rule:MF_00370} KW=Complete proteome; Reference proteome OX=453591 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125). GN=Igni_0540 OC=Desulfurococcaceae; Ignicoccus.
Sequence
MLESELPFAYAGGSALNAVASWKGAAFAISLKVEVKVVEGKRIDNKLLRSVYEVFKEQVC
DPGEVTFVVKSEVPPAGGLKSSSAVANAATLALFERCGMRPSPYYALKLSVEAAKRAGVT
VTGAFDDAAASMLGGLVITDNKEMVVEERRPLEGLRAIVLPRGGRGLSYGEVAERLRLLK
REFLKVYEMLKAGDLYGAMTLNGFLVAGALGYPQGPVLDALRAGALAASVSGNGPSYVAL
ADRDKVEDVYEALSKHGRPVVAEVVNSPAYLP
Download sequence
Identical sequences A8A9X0
gi|156937333|ref|YP_001435129.1| 453591.Igni_0540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]