SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8AB94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8AB94
Domain Number 1 Region: 1-197,416-664
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.59e-126
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000115
Further Details:      
 
Domain Number 2 Region: 199-416
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 2.72e-48
Family ValRS/IleRS/LeuRS editing domain 0.0000521
Further Details:      
 
Domain Number 3 Region: 673-893
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.87e-38
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0000778
Further Details:      
 
Domain Number 4 Region: 934-1021
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00000034
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8AB94
Sequence length 1025
Comment (tr|A8AB94|A8AB94_IGNH4) Isoleucyl-tRNA synthetase {ECO:0000313|EMBL:ABU82196.1} KW=Complete proteome; Reference proteome OX=453591 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125). GN=Igni_1017 OC=Desulfurococcaceae; Ignicoccus.
Sequence
MEPKYDPLKVEEEVFKFWKENKIYEKVKELSKKRGKVKLFRFLEGPPTANGFMHVGHMRG
RTYKDVILRFWRMKGYWVWDQAGWDTQGLPVELEVEKKHGFKSKKDILKYGVEKFVKECQ
ELVDYYISHWRADSERMGLWLDYDNAYETRHPKYLDAAWSYLKKMFDQGRIYKGLRVVAV
CPRCETALSSHEVALGYKTVKDPSFYFKLPLKDEEETYLVAWTTTPWTIIANEAAAVHPY
ETYVKIEVDANGKKEKWILAEKRLEPFAKEVGLKDYKVLEKFKGEELIGKEYVHPLLEEV
PAHKEHPKPHHTVIEGAVVRKKVLVNGKEIEEKQIFVSMDSGTGIVHMAPAHGAEDFEAC
RRVGIEVFRPIRKDGHFTEEAGKYAGMWFKEAEKEVIKDLKEKGLAVHVGTIEHEYPHCW
RCDTPLMYYADEQWFIKVEDLRETLVNENDKVTWYPKWAYDRMSDWLQNAKDWTISRERF
WGTPLPIWTCTSCGHRVAVSSLDELKKVALNPEAVVDHHRPWVDEVKLKCPKCGGVMVRE
PYVVDVWLDSGVAHTASLKQIGAEDYWDLFYPYDWITEALDQTRGWFYTLLVTGVTWHGR
APYKQVLTQGHILDKHGKKMSKSKGNVVWAKDVFKTYGADPVRFFFAIKSAPWDSVRFDP
EDIKLAKRTLDILWNSVKFAKSYMELDKWSLEKLEEGLKSLEPEDSWVLWKLNEYSKRVA
EELERSAIHRAAQALQEFIVEVLSHKYITLVRPRVWEEEETPSKLAAYSALFLALDAAIR
MSAPFVPFLAEYLYQRFQRALGFEEESVHMLQWPEENSLYDPEEAKAVEELLEAAEKVLA
LRTERGVKRRWPLPEAYVVVKSREEKAERVKVKRGNKEAEEVIYKPALSVVAVKRAAKAL
GVYANVLDVKVVEEPPAGDFDVIETESLKVYVKVRLDERTKMLGLAREVIRRIQTMRKEE
DLPLDYVLKKVIVFSDNEEILKAVEEFKEYVAKEVRAEEVVTSGEPPEGKEWSLEGSKVV
IALVK
Download sequence
Identical sequences A8AB94
WP_012123160.1.33635 gi|156937807|ref|YP_001435603.1| 453591.Igni_1017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]