SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8AC25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8AC25
Domain Number 1 Region: 6-350
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.07e-72
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8AC25
Sequence length 379
Comment (tr|A8AC25|A8AC25_IGNH4) Tryptophanyl-tRNA synthetase {ECO:0000313|EMBL:ABU82477.1} KW=Complete proteome; Reference proteome OX=453591 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125). GN=Igni_1301 OC=Desulfurococcaceae; Ignicoccus.
Sequence
MNGDLQKSTDYDRLIKVFGVTPLSEEVLNKLPERHKLFEIGYFFAHRDFDKVLEGWERGE
EFAILTGRGPSNVMHLGHMLLFDFVAWMQKTFKVPAYIPLSDDEKYVFLKVDSLREAAFY
AYDNALDIAALGFDEKKTYFFISTKTPEIYEMSVELSTEVTLNEVKAVFGFTDSDNPGKY
FYSVVQSAHILFPTVRKGYRSLVPIAIDQDPYIRLSRDIAERKKLPKPAALHSKYLPGLT
GEPMSASKPETAIFLDDPPKVIKEKIWKALTGGQPTVKEQREKGGDPERCVVFKWLEAFV
LDPKEAEEWKGRCRRGEVLCGECKKKLYEGIVRILKEHHERKLKLADKADKFFLHPVDWG
EVDKVKEKTKRLLEQFNLS
Download sequence
Identical sequences A8AC25
453591.Igni_1301 gi|156938088|ref|YP_001435884.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]