SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8AKN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8AKN7
Domain Number 1 Region: 22-336
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.83e-105
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000388
Further Details:      
 
Domain Number 2 Region: 338-466
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.6e-18
Family Glycosyl hydrolases family 32 C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8AKN7
Sequence length 468
Comment (tr|A8AKN7|A8AKN7_CITK8) Invertase {ECO:0000256|RuleBase:RU365015} KW=Complete proteome; Reference proteome OX=290338 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696). GN=CKO_02944 OC=Enterobacteriaceae; Citrobacter.
Sequence
MTLASRWPAVLQAVMQGQPCALADSHYPQWHPAPVTGLMNDPNGFIWFAGRYHLFYQWNP
LGCDHRYKCWGHWSSVDLVHWQHESIALMPDEEYDRNGCYSGSAVDNNGVLTLCYTGNVK
FDDGGRIAWQCLAVQNDDGSFTKQGPVLPLPEGYTGHVRDPKVWCHDGQWYMVLGAQDLQ
KQGKVLLFTSDDLHHWQPCGEIAGQGVNGLTDSGYMWECPDLFALDETHVLICCPQGLAR
EPHRYLNTYPSVWMSGAFDYETASFAHGELHELDAGFEFYAPQTTVAEDGRRILIGWMGV
PDGEEMLQPTCAYGWIHQMTCPRELKYRDGRLWQTPARELEQLREAEHQWQGRASDAPEL
EATRLEFELSTSYVNADFAGALRLTVDDYGVRLERASLKNGEMLTRYWQGDVSHLRVLCD
SSSIEIFINHGEGVMSSRYFPDHPARVRFEGASDITLRYWSLRRCMIE
Download sequence
Identical sequences A8AKN7
gi|157147167|ref|YP_001454486.1| 290338.CKO_02944 WP_012133763.1.88595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]