SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8E514 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8E514
Domain Number 1 Region: 232-288
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000122
Family PHD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8E514
Sequence length 296
Comment (tr|A8E514|A8E514_DANRE) Phf23a protein {ECO:0000313|EMBL:AAI53422.1} OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=phf23a OC=Cyprinidae; Danio.
Sequence
MLGIMDHHQDTVRKCKSEALPPERRKRTVEDFNKFCSFVLTYAGYIPPQKEESSWSPSSS
PCTHDLSELSGEGSVKDSWTDSHSDLNNIHNLVYKAETDSSSSREFSHLPSDNSLDKMTL
KDSLNHVHSKAERKKVKKLDRLSLGGPRKSISEARAHKQSKAALKKIKTSIKAERHFTSS
SPLNEGFEKEELTEQAIHMHEAGLKLESNQETDLSSCETDTLVTDEDIMVESGDDSWDLI
TCYCGKPFAGRPMIECEECSIWVHLSCAKIKKSNVPDIFYCYRCLDSRGSTVKRDH
Download sequence
Identical sequences A8E514 Q5BJ10
ENSDARP00000042480 ENSDARP00000042480 ENSDARP00000105631 7955.ENSDARP00000042480 NP_001013517.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]