SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8E9D3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8E9D3
Domain Number 1 Region: 2-234
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.21e-41
Family Dienelactone hydrolase 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8E9D3
Sequence length 243
Comment (tr|A8E9D3|A8E9D3_BURPE) Dienelactone hydrolase family protein {ECO:0000313|EMBL:EDO82960.1} KW=Complete proteome OX=360118 OS=Burkholderia pseudomallei 406e. GN=BURPS406E_B0913 OC=Burkholderiaceae; Burkholderia; pseudomallei group.
Sequence
METRSIAYDCGGARLTGYFADDAPNTKKPAVLIAHEAFGLNEHIRARARRLAELGYAAFA
LDMYGAEGFPMPEAIRRHIELMSTPGLMHARASAALSVLMEQPGVDRERVAAIGFCQGGI
SALELARGGAPIRCAVGFHPGLMRPAGSQDGPIRAKVLMMIGARDPDVPAADQAAFAAEM
QEKQVDWQLHLFGGVGHAYTNPDADGWNKPGYGYSRAADQRAWTMMLALFDEVFGGAAAV
GKA
Download sequence
Identical sequences A8E9D3
WP_004537853.1.101307 WP_004537853.1.10907 WP_004537853.1.21907 WP_004537853.1.37373 WP_004537853.1.37690 WP_004537853.1.42492 WP_004537853.1.44234 WP_004537853.1.45348 WP_004537853.1.59103 WP_004537853.1.64383 WP_004537853.1.67914 WP_004537853.1.72015 WP_004537853.1.79782 WP_004537853.1.80614 WP_004537853.1.82394 WP_004537853.1.91709 WP_004537853.1.93845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]