SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8FDD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8FDD7
Domain Number 1 Region: 7-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.57e-49
Family Ribonuclease PH domain 1-like 0.0000163
Further Details:      
 
Domain Number 2 Region: 292-488
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.57e-49
Family Ribonuclease PH domain 1-like 0.0000117
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.49e-30
Family Ribonuclease PH domain 2-like 0.002
Further Details:      
 
Domain Number 4 Region: 451-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.65e-27
Family Ribonuclease PH domain 2-like 0.0000875
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.97e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Domain Number 6 Region: 621-704
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.42e-20
Family Cold shock DNA-binding domain-like 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8FDD7
Sequence length 705
Comment (sp|A8FDD7|PNP_BACP2) Polynucleotide phosphorylase {ECO:0000255|HAMAP-Rule:MF_01595} KW=Complete proteome; Reference proteome OX=315750 OS=Bacillus pumilus (strain SAFR-032). GN=BPUM_1572; OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MGQEKHVFTIDWAGRQLTVETGQLAKQANGAVLVRYGDTAVLSSATASKEPKPLDFFPLT
VNYEERLYAVGKIPGGFIKREGRPSEKAILASRLIDRPIRPLFADGFRNEVQVISIVMSV
DQDCSSEMAAMFGSSLALCVSDIPFEGPIAGVTVGRVDGKFIINPNVEQLEQSDINLVVA
GTKDAINMVEAGADEVPEETMLEAIMYGHQEIKRLIEFQEEIVKAVGKAKIDIPLYEVDQ
TLADEVKALAETDLLKAIQVHEKHAREDAISAVKKAVVEKFEEEDRDEATIKQAKDVLNK
LVKNEVRRLITEEKVRPDGRGVDQIRPLSSEVGLLPRTHGSGLFTRGQTQALSICTLGAL
GDVQILDGLGVEESKRFMHHYNFPQFSVGETGPMRGPGRREIGHGALGERALEPVIPSEK
DFPYTVRLVSEVLESNGSTSQASICASTLAMMDAGVPIKAPVAGIAMGLVKSGEYYTVLT
DIQGMEDALGDMDFKVAGTSKGVTALQMDIKIDGLSKDILEEALQQAKKGRMEILDSMLS
TIPTSRGELSRYAPKILTMKINPDKIRDVIGPSGKQINKIIEDTGVKIDIEQDGTIFISS
TEEDMNQKAKKIIEDLVREVEVGQLYLGKVKRIEKFGAFLEIFSGKDGLVHISELALDRV
GKVEDVVKIGDELLVKVTEIDKQGRVNLSRKAVLREEKEKEEKQS
Download sequence
Identical sequences A0A200HDW2 A8FDD7
315750.BPUM_1572 WP_012009998.1.28396 WP_012009998.1.38286 gi|157692352|ref|YP_001486814.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]